OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tau-352 (0N3R) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313364
Recombinant protein of human microtubule-associated protein tau (MAPT) 0N3R, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA809201 MAPT mouse monoclonal antibody,clone OTI13B5 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tau or NM_016841.5"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213364 representing NM_016841
Red=Cloning site Green=Tags(s)

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMV
SKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYS
SPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKH
QPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNK
KIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQ
GL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.6 kDa
Concentration >100 ug/mL as determined by Microplate BCA Protein Assay method
Purity > 90% as determined by SDS-PAGE and Coomassie blue staining
Buffer 50 mM Tris-HCl, 100 mM glycine and 10% glycerol, pH 7.5
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_058525.1
Locus ID 4137
UniProt ID P10636-2
Cytogenetics 17q21.31
RefSeq Size 2529
RefSeq ORF 1056
Synonyms 0N3R; DDPAC; Fetal-tau; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU; tau-40
Summary This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Tau" proteins (16)
SKU Description Size Price
PH313312 MAPT MS Standard C13 and N15-labeled recombinant protein (NP_005901) 10 ug
$3,360.00
PH313364 MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525) 10 ug
$3,360.00
PH317773 MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058518) 10 ug
$3,360.00
LC401790 Lyophilized tau (MAPT) 2N4R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413819 Lyophilized tau (MAPT) 0N4R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413820 Lyophilized tau (MAPT), transcript variant 1 (PNS-Tau/Big Tau) HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413823 Lyophilized tau (MAPT) 0N3R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426599 Lyophilized tau (MAPT) 1N4R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401790 Transient overexpression lysate of microtubule-associated protein tau (MAPT) 2N4R (as WB positive control) 100 ug
$665.00
LY413819 Transient overexpression lysate of microtubule-associated protein tau (MAPT) 0N4R (as WB positive control) 100 ug
$436.00
LY413820 Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 (PNS-Tau/Big Tau) (as WB positive control) 100 ug
$665.00
LY413823 Transient overexpression lysate of microtubule-associated protein tau (MAPT) 0N3R (as WB positive control) 100 ug
$436.00
LY426599 Transient overexpression lysate of microtubule-associated protein tau (MAPT) 1N4R (as WB positive control) 100 ug
$436.00
TP313312 Recombinant protein of human microtubule-associated protein tau (MAPT) 2N4R, 20 µg 20 ug
$867.00
TP317773 Recombinant protein of human microtubule-associated protein tau (MAPT) 0N4R, 20 µg 20 ug
$867.00
TP720155 Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 6 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products