ENTPD3 (NM_001248) Human Recombinant Protein

CAT#: TP312912

Recombinant protein of human ectonucleoside triphosphate diphosphohydrolase 3 (ENTPD3), 20 µg

Product Images

Coomassie blue staining of purified ENTPD3 protein (Cat# TP312912). The protein was produced from HEK293T cells transfected with ENTPD3 cDNA clone (Cat# RC212912) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC212912
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTT
  VYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGA
  TAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWV
  HPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLL
  QNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFK
  ACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFD
  EVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIE
  PPVFVGTLAFFTAAALLCLAFLAYLCSATRRKRHSEHAFDHAVDSD
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC212912 also available, TP312912
• Tag: C-Myc/DDK
• Predicted MW: 58.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001239
• Locus ID: 956
• UniProt ID: O75355
• Cytogenetics: 3p22.1
• Refseq Size: 2797
• Refseq ORF: 1596
• Synonyms: CD39L3; HB6; NTPDase-3
• Summary: This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described. [provided by RefSeq, May 2014]
• Protein Families: Transmembrane
• Protein Pathways: Purine metabolism, Pyrimidine metabolism