OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Myoglobin (MB) (NM_005368) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP312352
Recombinant protein of human myoglobin (MB), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA350196 Rabbit Polyclonal Anti-MB Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Myoglobin or NM_005368"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212352 representing NM_005368
Red=Cloning site Green=Tags(s)

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL
TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR
KDMASNYKELGFQG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005359
Locus ID 4151
UniProt ID P02144
Cytogenetics 22q12.3
RefSeq Size 1078
RefSeq ORF 462
Synonyms PVALB
Summary This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. provided by RefSeq, May 2020
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Myoglobin" proteins (10)
SKU Description Size Price
PH303113 MB MS Standard C13 and N15-labeled recombinant protein (NP_976312) 10 ug
$3,360.00
PH312352 MB MS Standard C13 and N15-labeled recombinant protein (NP_005359) 10 ug
$3,360.00
LC404319 Lyophilized MB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404320 Lyophilized MB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417346 Lyophilized MB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404319 Transient overexpression lysate of myoglobin (MB), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404320 Transient overexpression lysate of myoglobin (MB), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY417346 Transient overexpression lysate of myoglobin (MB), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303113 Recombinant protein of human myoglobin (MB), transcript variant 3, 20 µg 20 ug
$737.00
TP761636 Purified recombinant protein of Human myoglobin (MB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

Calmodulin activates the Hippo signaling pathway by promoting LATS1 kinase-mediated inhibitory phosphorylation of the transcriptional coactivator YAP
Thines, Gorisse, Li et al
J Biol Chem (2022) 298 (5), 101839 DOI: 10.1016/j.jbc.2022.101839
Cited by 14
AI Summary: In this study, OriGene products including the LATS1 (RC210590) and YAP (RC208951) expression plasmids were used to overexpress these proteins in mammalian cells, enabling the investigation of calmodulin’s role in activating the Hippo signaling pathway through LATS1-mediated phosphorylation of YAP.
Snippet: The Hippo signaling pathway regulates tissue growth and cell fate, and its dysregulation can induce tumorigenesis. When Hippo is activated by cell-cell contact, extracellular signals, or cell polarity among others, the large tumor suppressor 1 (LATS1) kinase catalyzes inhibitory phosphorylation of the transcriptional coactivator Yes-associated protein (YAP) to maintain YAP in the cytoplasm or prom...
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products