OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Myoglobin (MB) (NM_005368) Human Mass Spec Standard

Be the first to review this product
SKU
PH312352
MB MS Standard C13 and N15-labeled recombinant protein (NP_005359)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350196 Rabbit Polyclonal Anti-MB Antibody
100 ul
$205.00
LY404319 Transient overexpression lysate of myoglobin (MB), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "Myoglobin or NM_005368"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212352
Predicted MW 17 kDa
Protein Sequence
Protein Sequence
>RC212352 representing NM_005368
Red=Cloning site Green=Tags(s)

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL
TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR
KDMASNYKELGFQG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005359
RefSeq Size 1078
RefSeq ORF 462
Synonyms PVALB
Locus ID 4151
UniProt ID P02144
Cytogenetics 22q12.3
Summary This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. provided by RefSeq, May 2020
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Myoglobin" proteins (10)
SKU Description Size Price
PH303113 MB MS Standard C13 and N15-labeled recombinant protein (NP_976312) 10 ug
$3,360.00
LC404319 Lyophilized MB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404320 Lyophilized MB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417346 Lyophilized MB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404319 Transient overexpression lysate of myoglobin (MB), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404320 Transient overexpression lysate of myoglobin (MB), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY417346 Transient overexpression lysate of myoglobin (MB), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303113 Recombinant protein of human myoglobin (MB), transcript variant 3, 20 µg 20 ug
$737.00
TP312352 Recombinant protein of human myoglobin (MB), transcript variant 1, 20 µg 20 ug
$737.00
TP761636 Purified recombinant protein of Human myoglobin (MB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products