PML Protein (PML) (NM_033239) Human Recombinant Protein

  • Product Brand Image
SKU
TP312067
Recombinant protein of human promyelocytic leukemia (PML), transcript variant 9, 20 µg
In Control Promo
  $867.00
4 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212067 representing NM_033239
Red=Cloning site Green=Tags(s)

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL
PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC
FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP
LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR
ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG
FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIK
MESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVIS
SSEDSDAENSCMEPMETAEPQSSPAHSSPAHSSPAHSSPVQSLLRAQGASSLPCGTYHPPAWPPHQPAEQ
AATPDAEPHSEPPDHQERPAVHRGIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQASTPAITG
PLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLSQWLNNFFALPFSSMASQLDMSSVVGAG
ESRAQTLGAGVPPGDSVRGSMEASQVQVPLEASPITFPPPCAPERPPISPVPGARQAGL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 90.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_150242
Locus ID 5371
UniProt ID P29590
Cytogenetics 15q24.1
RefSeq Size 3088
RefSeq ORF 2487
Synonyms MYL; PP8675; RNF71; TRIM19
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2008
Protein Categories Cancer: Haematopoietic and Lymphoid, Cytokines, Growth Factors, Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "PML Protein" proteins (15)
SKU Description Size Price
PH312067 PML MS Standard C13 and N15-labeled recombinant protein (NP_150242) 10 ug
$3,360.00
PH320236 PML MS Standard C13 and N15-labeled recombinant protein (NP_150247) 10 ug
$3,360.00
PH320522 PML MS Standard C13 and N15-labeled recombinant protein (NP_150249) 10 ug
$3,360.00
LC409649 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409651 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409652 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409653 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409655 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409649 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 9 100 ug
$665.00
LY409651 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 5 100 ug
$665.00
LY409652 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 7 100 ug
$665.00
LY409653 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 8 100 ug
$665.00
LY409655 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 11 100 ug
$436.00
TP320236 Recombinant protein of human promyelocytic leukemia (PML), transcript variant 5, 20 µg 20 ug
$867.00
TP320522 Purified recombinant protein of Homo sapiens promyelocytic leukemia (PML), transcript variant 7, 20 µg 20 ug
$867.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.