PML Protein (PML) (NM_033246) Human Recombinant Protein
SKU
TP320522
Purified recombinant protein of Homo sapiens promyelocytic leukemia (PML), transcript variant 7, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC220522 representing NM_033246
Red=Cloning site Green=Tags(s) MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLRN ALW SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 47.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_150249 |
Locus ID | 5371 |
UniProt ID | P29590 |
Cytogenetics | 15q24.1 |
RefSeq Size | 1851 |
RefSeq ORF | 1269 |
Synonyms | MYL; PP8675; RNF71; TRIM19 |
Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312067 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150242) | 10 ug |
$3,255.00
|
|
PH320236 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150247) | 10 ug |
$3,255.00
|
|
PH320522 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150249) | 10 ug |
$3,255.00
|
|
LC409649 | PML HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC409651 | PML HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC409652 | PML HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC409653 | PML HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC409655 | PML HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY409649 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 9 | 100 ug |
$665.00
|
|
LY409651 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 5 | 100 ug |
$665.00
|
|
LY409652 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 7 | 100 ug |
$665.00
|
|
LY409653 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 8 | 100 ug |
$665.00
|
|
LY409655 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 11 | 100 ug |
$436.00
|
|
TP312067 | Recombinant protein of human promyelocytic leukemia (PML), transcript variant 9, 20 µg | 20 ug |
$867.00
|
|
TP320236 | Recombinant protein of human promyelocytic leukemia (PML), transcript variant 5, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.