PML Protein (PML) (NM_033244) Human Mass Spec Standard

SKU
PH320236
PML MS Standard C13 and N15-labeled recombinant protein (NP_150247)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220236]
Predicted MW 61.8 kDa
Protein Sequence
Protein Sequence
>RC220236 representing NM_033244
Red=Cloning site Green=Tags(s)

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL
PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC
FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP
LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR
ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG
FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIK
MESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGRERNALW

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150247
RefSeq Size 3096
RefSeq ORF 1680
Synonyms MYL; PP8675; RNF71; TRIM19
Locus ID 5371
UniProt ID P29590
Cytogenetics 15q24.1
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:PML Protein (PML) (NM_033244) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312067 PML MS Standard C13 and N15-labeled recombinant protein (NP_150242) 10 ug
$3,255.00
PH320522 PML MS Standard C13 and N15-labeled recombinant protein (NP_150249) 10 ug
$3,255.00
LC409649 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409651 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409652 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409653 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409655 PML HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409649 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 9 100 ug
$665.00
LY409651 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 5 100 ug
$665.00
LY409652 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 7 100 ug
$665.00
LY409653 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 8 100 ug
$665.00
LY409655 Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 11 100 ug
$436.00
TP312067 Recombinant protein of human promyelocytic leukemia (PML), transcript variant 9, 20 µg 20 ug
$867.00
TP320236 Recombinant protein of human promyelocytic leukemia (PML), transcript variant 5, 20 µg 20 ug
$867.00
TP320522 Purified recombinant protein of Homo sapiens promyelocytic leukemia (PML), transcript variant 7, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.