OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PML Protein (PML) (NM_033244) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC220236
PML (Myc-DDK-tagged)-Human promyelocytic leukemia (PML), transcript variant 5
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $521.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA591018 Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
100 ul
$519.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PML Protein or NM_033244"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PML Protein
Synonyms MYL; PP8675; RNF71; TRIM19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220236 representing NM_033244
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCTGCACCCGCCCGATCTCCGAGGCCCCAGCAGGACCCCGCCCGGCCCCAGGAGCCCACCATGC
CTCCCCCCGAGACCCCCTCTGAAGGCCGCCAGCCCAGCCCCAGCCCCAGCCCTACAGAGCGAGCCCCCGC
TTCGGAGGAGGAGTTCCAGTTTCTGCGCTGCCAGCAATGCCAGGCGGAAGCCAAGTGCCCGAAGCTGCTG
CCTTGTCTGCACACGCTGTGCTCAGGATGCCTGGAGGCGTCGGGCATGCAGTGCCCCATCTGCCAGGCGC
CCTGGCCCCTAGGTGCAGACACACCCGCCCTGGATAACGTCTTTTTCGAGAGTCTGCAGCGGCGCCTGTC
GGTGTACCGGCAGATTGTGGATGCGCAGGCTGTGTGCACCCGCTGCAAAGAGTCGGCCGACTTCTGGTGC
TTTGAGTGCGAGCAGCTCCTCTGCGCCAAGTGCTTCGAGGCACACCAGTGGTTCCTCAAGCACGAGGCCC
GGCCCCTAGCAGAGCTGCGCAACCAGTCGGTGCGTGAGTTCCTGGACGGCACCCGCAAGACCAACAACAT
CTTCTGCTCCAACCCCAACCACCGCACCCCTACGCTGACCAGCATCTACTGCCGAGGATGTTCCAAGCCG
CTGTGCTGCTCGTGCGCGCTCCTTGACAGCAGCCACAGTGAGCTCAAGTGCGACATCAGCGCAGAGATCC
AGCAGCGACAGGAGGAGCTGGACGCCATGACGCAGGCGCTGCAGGAGCAGGATAGTGCCTTTGGCGCGGT
TCACGCGCAGATGCACGCGGCCGTCGGCCAGCTGGGCCGCGCGCGTGCCGAGACCGAGGAGCTGATCCGC
GAGCGCGTGCGCCAGGTGGTAGCTCACGTGCGGGCTCAGGAGCGCGAGCTGCTGGAGGCTGTGGACGCGC
GGTACCAGCGCGACTACGAGGAGATGGCCAGTCGGCTGGGCCGCCTGGATGCTGTGCTGCAGCGCATCCG
CACGGGCAGCGCGCTGGTGCAGAGGATGAAGTGCTACGCCTCGGACCAGGAGGTGCTGGACATGCACGGT
TTCCTGCGCCAGGCGCTCTGCCGCCTGCGCCAGGAGGAGCCCCAGAGCCTGCAAGCTGCCGTGCGCACCG
ATGGCTTCGACGAGTTCAAGGTGCGCCTGCAGGACCTCAGCTCTTGCATCACCCAGGGGAAAGATGCAGC
TGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTATTGACGTTGACCTGCCCGAG
GAGGCAGAGAGAGTGAAGGCCCAGGTTCAGGCCCTGGGGCTGGCTGAAGCCCAGCCTATGGCTGTGGTAC
AGTCAGTGCCCGGGGCACACCCCGTGCCAGTGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGA
TGTCTCCAATACAACGACAGCCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAG
ATGGAGTCTGAGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAGGAAGTGAGGT
CTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGGTAGGGAGAGGAACGCGTTGTGG

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC220236 representing NM_033244
Red=Cloning site Green=Tags(s)

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL
PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC
FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP
LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR
ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG
FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIK
MESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGRERNALW

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_033244
ORF Size 1680 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033244.4
RefSeq Size 3096 bp
RefSeq ORF 1683 bp
Locus ID 5371
UniProt ID P29590
Cytogenetics 15q24.1
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis
MW 61.8 kDa
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_033244" in other vectors (6)
SKU Description Size Price
RC220236L1 Lenti ORF clone of Human promyelocytic leukemia (PML), transcript variant 5, Myc-DDK-tagged 10 ug
$821.00
RC220236L2 Lenti ORF clone of Human promyelocytic leukemia (PML), transcript variant 5, mGFP tagged 10 ug
$821.00
RC220236L3 Lenti ORF clone of Human promyelocytic leukemia (PML), transcript variant 5, Myc-DDK-tagged 10 ug
$821.00
RC220236L4 Lenti ORF clone of Human promyelocytic leukemia (PML), transcript variant 5, mGFP tagged 10 ug
$821.00
RG220236 PML (tGFP-tagged) - Human promyelocytic leukemia (PML), transcript variant 5 10 ug
$721.00
SC128164 PML (untagged)-Human promyelocytic leukemia (PML), transcript variant 5 10 ug
$522.00

Plasmid Map for RC220236

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC220236
Circular map for RC220236

file-alt Citations

Biological differences in promyelocytic leukemia (PML) proteins between PML-nuclear bodies (PML-NBs) and extranuclear PML bodies (EnPBs) in arsenite-exposed cells
Hirano, Udagawa
bioRxiv (2026)
AI Summary: OriGene's PMLVI plasmid (RC220236) was used to transfect U-2OS cells, enabling the stable overexpression of PML-VI protein for investigating the biological differences between PML-nuclear bodies and extranuclear PML bodies in arsenite-exposed cells.
Snippet: U-2OS cells (HTB-96) were obtained from ATCC and cultured in McCoy’s 5A medium containing 10% heat-inactivated fetal bovine serum (FBS). The cells were transfected with PMLVI plasmid (RC220236, transcript variant 5, Origene, Rockville, MD), and cells stably expressing PML-VI were selected by G418 (PML(VI)-U2OS cells)
Arsenic induces two different interaction modes of SUMO with promyelocytic leukemia (PML) proteins
Hirano, Udagawa, Kato-Udagawa
bioRxiv (2023)
Cited by 1
Snippet: …PML double nickase plasmid (Santa Cruz, Dallas, TX) was transduced into HEK293 cells using Lipofectamine LTX (Invitrogen-ThermoFisher) to knock out PML by the CRISPR-Cas9 system. The stable transfectants were selected using puromycin and designated as PML-/- cells. HEK293, which were stably transfected with the human PML-VI gene (RC220236, OriGene, Rockville, MD), w
SUMOylation regulates the number and size of promyelocytic leukemia-nuclear bodies (PML-NBs) and arsenic perturbs SUMO dynamics on PML by insolubilizing PML in THP-1 cells
Hirano, Udagawa
Arch Toxicol (2022)
Cited by 16
AI Summary: OriGene’s human PMLVI gene (RC220236) was used to stably transfect CHO-K1 cells, enabling the study of SUMOylation and its effects on promyelocytic leukemia-nuclear bodies (PML-NBs) in this research.
Snippet: CHO-K1 cells were stably transfected with the human PMLVI gene (RC220236, OriGene, Rockville, MD)
Inherited GATA2 Deficiency Is Dominant by Haploinsufficiency and Displays Incomplete Clinical Penetrance
Oleaga-Quintas, de Oliveira-Júnior, Rosain et al
J Clin Immunol (2021)
Cited by 51
AI Summary: OriGene products, specifically the GATA2-wild-type isoform 1 (RC208554) and isoform 2 (RC227514) plasmids, were used to express GATA2 variants in functional studies investigating the genetic mechanisms underlying GATA2 deficiency.
Snippet: PCMV6 empty plasmid (EV), GATA2-wild-type (WT) isoform 1 (Origene RC208554), and GATA2-WT isoform 2 (Origene RC227514) were used to transform competent TOP 10 cells (Invitrogen, C404006)
Solubility changes of promyelocytic leukemia (PML) and SUMO monomers and dynamics of PML nuclear body proteins in arsenite-treated cells
Hirano, Udagawa, Kobayashi et al
Toxicol. Appl. Pharmacol. (2018) 360, 150-159 DOI: 10.1016/j.taap.2018.10.001
AI Summary: OriGene’s pCMV6-ENTRY vector (RC220236), encoding PML transcript variant 5 (PML-VI), was used to generate stably transfected cells for investigating the solubility and nuclear localization dynamics of PML in response to arsenite treatment.
Snippet: The stably transfected cells were further transfected with a pCMV6-ENTRY vector (RC220236, OriGene, Rockville, MD) encoding PML transcript variant 5 or PML-VI (Accession No.: NM_033244.3) and stably transfected cells were selected in G418-containing culture
Solubility shift and SUMOylaltion of promyelocytic leukemia (PML) protein in response to arsenic(III) and fate of the SUMOylated PML
Hirano, Tadano, Kobayashi et al
Toxicol. Appl. Pharmacol. (2015)
Cited by 16
AI Summary: OriGene’s pCMV6-ENTRY vector containing human PML-VI (catalog #RC220236) was used to stably transfect HEK293 cells, enabling the study of PML protein solubility and SUMOylation in response to arsenic(III) in this research.
Snippet: Briefly, human PML-VI (PML transcript variant 5, Accession No. NM_033244.3) engineered into pCMV6-ENTRY vector (RC220236, Origene, Rockville, MD) was transduced into HEK293 cells using Lipofectamine LTX-PLUS (Life Technology). ... Cite SaveSaving
Showing 1-6 of 7 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products