OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tuberoinfundibular peptide (PTH2) (NM_178449) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310906
Recombinant protein of human parathyroid hormone 2 (PTH2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA337573 Rabbit Polyclonal Anti-PTH2 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tuberoinfundibular peptide or NM_178449"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210906 protein sequence
Red=Cloning site Green=Tags(s)

METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAA
FRERARLLAALERRHWLNSYMHKLLVLDAP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_848544
Locus ID 113091
UniProt ID Q96A98
Cytogenetics 19q13.33
RefSeq Size 459
RefSeq ORF 300
Synonyms TIP39
Summary This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. provided by RefSeq, Jul 2015
Protein Categories Secreated Proteins
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Tuberoinfundibular peptide" proteins (3)
SKU Description Size Price
PH310906 PTH2 MS Standard C13 and N15-labeled recombinant protein (NP_848544) 10 ug
$3,360.00
LC403603 Lyophilized PTH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403603 Transient overexpression lysate of parathyroid hormone 2 (PTH2) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products