Tuberoinfundibular peptide (PTH2) (NM_178449) Human Recombinant Protein

SKU TP310906

Recombinant protein of human parathyroid hormone 2 (PTH2), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210906 protein sequence; Red=Cloning site Green=Tags(s); ; METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAA; FRERARLLAALERRHWLNSYMHKLLVLDAP; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_848544
• Locus ID: 113091
• UniProt ID: Q96A98
• Cytogenetics: 19q13.33
• RefSeq Size: 459
• RefSeq ORF: 300
• Synonyms: TIP39
• Summary: This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. [provided by RefSeq, Jul 2015]
• Protein Families: Secreted Protein, Transmembrane