Tuberoinfundibular peptide (PTH2) Rabbit Polyclonal Antibody

SKU TA337573

Rabbit Polyclonal Anti-PTH2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTH2 antibody: synthetic peptide directed towards the middle region of human PTH2. Synthetic peptide located within the following region: WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 11 kDa
• Gene Name: parathyroid hormone 2
• Database Link:
  NP_848544
  Q96A98
• Background: TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.TIP39 is related to parathyroid hormone (PTH; MIM 168450) and PTH-related protein (PTHRP; MIM 168470) and is a ligand for PTH receptor-2 (PTHR2; MIM 601469) (John et al., 2002 [PubMed 11861531]). [supplied by OMIM]
• Synonyms: TIP39
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: Secreted Protein, Transmembrane