Tuberoinfundibular peptide (PTH2) (NM_178449) Human Mass Spec Standard

SKU PH310906

PTH2 MS Standard C13 and N15-labeled recombinant protein (NP_848544)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210906]
• Predicted MW: 11.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC210906 protein sequence; Red=Cloning site Green=Tags(s); ; METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAA; FRERARLLAALERRHWLNSYMHKLLVLDAP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_848544
• RefSeq Size: 459
• RefSeq ORF: 300
• Synonyms: TIP39
• Locus ID: 113091
• UniProt ID: Q96A98
• Cytogenetics: 19q13.33
• Summary: This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. [provided by RefSeq, Jul 2015]
• Protein Families: Secreted Protein, Transmembrane