Serum Amyloid A (SAA1) (NM_000331) Human Recombinant Protein

  • Product Brand Image
SKU
TP310664
Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 1, 20 µg
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210664 protein sequence
Red=Cloning site Green=Tags(s)

MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV
WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000322
Locus ID 6288
UniProt ID P0DJI8
Cytogenetics 11p15.1
RefSeq Size 678
RefSeq ORF 366
Synonyms PIG4; SAA; SAA2; TP53I4
Summary This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. provided by RefSeq, Jul 2020
Protein Categories Cytokines, Secreated Proteins
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Serum Amyloid A" proteins (9)
SKU Description Size Price
PH302738 SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_954630) 10 ug
$3,360.00
PH310664 SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_000322) 10 ug
$3,360.00
LC403693 Lyophilized SAA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424788 Lyophilized SAA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403693 Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424788 Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302738 Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 2, 20 µg 20 ug
$867.00
TP750173 Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1, 19Arg-End, with N-terminal HIS tag, expressed in E.Coli, 50 ug 50 ug
$270.00
TP762437 Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 2, Arg19-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products