Serum Amyloid A (SAA1) (NM_199161) Human Mass Spec Standard

SKU
PH302738
SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_954630)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202738]
Predicted MW 13.5 kDa
Protein Sequence
Protein Sequence
>RC202738 protein sequence
Red=Cloning site Green=Tags(s)

MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV
WAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_954630
RefSeq Size 531
RefSeq ORF 366
Synonyms PIG4; SAA; SAA2; TP53I4
Locus ID 6288
UniProt ID P0DJI8
Cytogenetics 11p15.1
Summary This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020]
Write Your Own Review
You're reviewing:Serum Amyloid A (SAA1) (NM_199161) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310664 SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_000322) 10 ug
$3,255.00
LC403693 SAA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424788 SAA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403693 Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 2 100 ug
$436.00
LY424788 Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 1 100 ug
$436.00
TP302738 Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 2, 20 µg 20 ug
$867.00
TP310664 Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 1, 20 µg 20 ug
$867.00
TP750173 Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1, 19Arg-End, with N-terminal HIS tag, expressed in E.Coli, 50 ug 50 ug
$261.00
TP762437 Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 2, Arg19-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.