OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUT (NM_001025249) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310600
Purified recombinant protein of Homo sapiens deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA375661 DUT Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DUT or NM_001025249"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210600 representing NM_001025249
Red=Cloning site Green=Tags(s)

MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA
STVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYS
AYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE
VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001020420
Locus ID 1854
UniProt ID P33316
Cytogenetics 15q21.1
RefSeq Size 1830
RefSeq ORF 756
Synonyms dUTPase
Summary This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUT" proteins (8)
SKU Description Size Price
PH310600 DUT MS Standard C13 and N15-labeled recombinant protein (NP_001020420) 10 ug
$3,360.00
PH321635 DUT MS Standard C13 and N15-labeled recombinant protein (NP_001939) 10 ug
$3,360.00
LC400715 Lyophilized DUT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422498 Lyophilized DUT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400715 Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422498 Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 (as WB positive control) 100 ug
$436.00
TP321635 Recombinant protein of human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$867.00
TP720892 Purified recombinant protein of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products