DUT (NM_001948) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC221635] |
Predicted MW | 17.6 kDa |
Protein Sequence |
Protein Sequence
>RC221635 representing NM_001948
Red=Cloning site Green=Tags(s) MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDI QIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYP EIEEVQALDDTERGSGGFGSTGKN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001939 |
RefSeq Size | 1874 |
RefSeq ORF | 492 |
Synonyms | dUTPase |
Locus ID | 1854 |
UniProt ID | P33316 |
Cytogenetics | 15q21.1 |
Summary | This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310600 | DUT MS Standard C13 and N15-labeled recombinant protein (NP_001020420) | 10 ug |
$3,255.00
|
|
LC400715 | DUT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422498 | DUT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400715 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2 | 100 ug |
$436.00
|
|
LY422498 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 | 100 ug |
$436.00
|
|
TP310600 | Purified recombinant protein of Homo sapiens deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP321635 | Recombinant protein of human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720892 | Purified recombinant protein of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 1 | 10 ug |
$250.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.