OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Isocitrate dehydrogenase (IDH1) (NM_005896) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310582
Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500610 Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Isocitrate dehydrogenase or NM_005896"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210582 protein sequence
Red=Cloning site Green=Tags(s)

MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVG
VKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYR
ATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLS
TKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDS
VAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK
ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzymatic activities were determined by monitoring NADPH formation based on the absorbance at 345nm. The reaction was carried out at 37? for 10 minutes in the presence of isocitrate as a substrate and NADP as a cofactor. The data which presented a good linear relation on the curve was used to calculate the specific activity, and one unit is defined as converting 1.0 umole of NADP to NADPH per min at 37?. In summary, the wildtype IDH1 produced from HEK293 cells and insect cells are active while the R132H mutant or the WT/R132H heterodimers are inactive.
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005887
Locus ID 3417
UniProt ID O75874
Cytogenetics 2q34
RefSeq Size 2339
RefSeq ORF 1242
Synonyms HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Summary Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Sep 2013
Protein Categories Cancer: Brain and CNS, Cancer: Haematopoietic and Lymphoid, Cardiovascular diseases, Intracellular Proteins
Protein Pathways Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Isocitrate dehydrogenase" proteins (19)
SKU Description Size Price
PH310582 IDH1 MS Standard C13 and N15-labeled recombinant protein (NP_005887) 10 ug
$3,360.00
LC401782 Lyophilized IDH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401782 Transient overexpression lysate of isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) (as WB positive control) 100 ug
$436.00
TP700038 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1 mutant R132H),with C-terminal Myc-DDK tag, expressed in HEK293 cells 20 ug
$900.00
TP700039 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1 mutant R132C),with C-terminal Myc-DDK tag, expressed in HEK293 cells 20 ug
$900.00
TP700040 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1 mutant R132L),with C-terminal Myc-DDK tag, expressed in HEK293 cells 20 ug
$900.00
TP700041 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1 mutant R132S),with C-terminal Myc-DDK tag, expressed in HEK293 cells 20 ug
$900.00
TP700042 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1 mutant R132G),with C-terminal Myc-DDK tag, expressed in HEK293 cells 20 ug
$900.00
TP710042 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), with C-terminal polyhistidine tag, expressed in sf9 cells. 20 ug
$540.00
TP710043 Recombinant protein of mutant(R132H) of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1),with C-terminal DDK tag,expressed in sf9 cells. 20 ug
$540.00
TP710044 Recombinant protein of mutant(R132C) of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1),with C-terminal DDK tag,expressed in sf9 cells 20 ug
$540.00
TP710045 Recombinant protein of mutant(R132L) of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1),with C-terminal DDK tag,expressed in sf9 cells. 20 ug
$540.00
TP710046 Recombinant protein of mutant(R132S) of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1),with C-terminal DDK tag,expressed in sf9 cells. 20 ug
$540.00
TP710047 Recombinant protein of mutant(R132G) of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1),with C-terminal DDK tag,expressed in sf9 cells. 20 ug
$540.00
TP710048 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) and mutant(R132H) heterodimer, with C-terminal polyhistidine and DDK tags, expressed in sf9 cells. 20 ug
$540.00
TP710049 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) and mutant(R132C) heterodimer, with C-terminal polyhistidine and DDK tags, expressed in sf9 cells 20 ug
$540.00
TP710050 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) and mutant(R132L) heterodimer, with C-terminal polyhistidine and DDK tags, expressed in sf9 cells 20 ug
$540.00
TP710051 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) and mutant(R132S) heterodimer, with C-terminal polyhistidine and DDK tags, expressed in sf9 cells 20 ug
$540.00
TP710052 Recombinant protein of human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) and mutant(R132G) heterodimer, with C-terminal polyhistidine and DDK tags, expressed in sf9 cells 20 ug
$540.00

file-alt Citations

Antibody Validation for Western blot: By the User, for the User
Pillai-Kastoori, Heaton, Shiflett et al
J. Biol. Chem. (2019) 295 (4), 926-939 DOI: 10.1074/jbc.RA119.010472
AI Summary: OriGene products—including human recombinant IDH1 protein (TP310582), IDH1 over-expression lysate (LY401782), parental HEK293T lysate (LY500001), IDH1 knockout cell lysate (LC810112), parental HeLa control lysate (LC810Hela), and 2x SDS buffer—were used as standardized controls and reagents to validate antibody specificity and reproducibility in Western blot experiments.
Snippet: Isocitrate dehydrogenase (IDH1) (NM_005896) human recombinant protein (OriGene# TP310582), IDH1(NM_005896) human over-expression lysate supplied with parental HEK293T lysate (OriGene# LY401782;HEK293T LY500001;Lot #0076CF), IDH1 Knockout cell lysate (supplied with Parental HeLa control lysate) (Origene #LC810112, LC810Hela;Lot #1601), were mixed with either 2X protein loading buffer (PLB) (LICOR# 928-40004) OR 2x SDS buffer (OriGene) and denatured by boiling at 97oC for 5 minutes. …
G6pd Deficiency Does Not Affect the Cytosolic Glutathione or Thioredoxin Antioxidant Defense in Mouse Cochlea
White, Kim, Ding et al
J. Neurosci. (2017) 37 (23), 5770-5781 DOI: 10.1523/JNEUROSCI.0519-17.2017
AI Summary: OriGene’s siRNAs targeting mouse G6pd and Idh1 were used to knock down these genes in HEI-OC1 cells, enabling the study to assess the specific roles of each enzyme in cytosolic antioxidant defense in the mouse cochlea.
Snippet: To generate siRNA-mediated knockdown cells, HEI-OC1 cells (3 × 105 cells per well) were plated on a 6 well plate the day before transfection. siRNA (Origene) targeted to mouse G6pd or Idh1 and scrambled siRNA (control) were transfected with lipofectamine RNAi max (Invitrogen) according to the manufacturer's instructions
A Highly Facile and Specific Assay for Cancer-Causing Isocitrate Dehydrogenase Mutant Using (13)C4-Labeled α-Ketoglutarate and Heteronuclear NMR
Wen, Yun, Xu et al
Anal. Chem. (2013)
Cited by 3
AI Summary: OriGene contributed recombinant wild-type and mutant isocitrate dehydrogenase 1 (WT- and MT-IDH1) enzymes to this study, enabling the authors to develop and validate their specific NMR-based assay for detecting cancer-associated IDH mutations.
Snippet: Chemicals and Reagents The stable isotope 13 C 4 -labeled α-ketoglutarate (1,2,3,4- 13 C 4 , 99%) was purchased from Cambridge Isotope Labratories (Andover, MA). Recombinant WT- and MT-IDH (both for isotype 1) were purchased from Origene (Rockville, MD ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products