OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAPS (NM_004058) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310271
Recombinant protein of human calcyphosine (CAPS), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CAPS or NM_004058"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210271 protein sequence
Red=Cloning site Green=Tags(s)

MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV
LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004049
Locus ID 828
UniProt ID Q13938
Cytogenetics 19p13.3
RefSeq Size 1613
RefSeq ORF 567
Synonyms CAPS1
Summary This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAPS" proteins (7)
SKU Description Size Price
PH310271 CAPS MS Standard C13 and N15-labeled recombinant protein (NP_004049) 10 ug
$3,360.00
PH315422 CAPS MS Standard C13 and N15-labeled recombinant protein (NP_542157) 10 ug
$3,360.00
LC409138 Lyophilized CAPS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418250 Lyophilized CAPS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409138 Transient overexpression lysate of calcyphosine (CAPS), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418250 Transient overexpression lysate of calcyphosine (CAPS), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP315422 Recombinant protein of human calcyphosine (CAPS), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products