OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAPS (NM_004058) Human Mass Spec Standard

Be the first to review this product
SKU
PH310271
CAPS MS Standard C13 and N15-labeled recombinant protein (NP_004049)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409138 Transient overexpression lysate of calcyphosine (CAPS), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CAPS or NM_004058"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210271
Predicted MW 21 kDa
Protein Sequence
Protein Sequence
>RC210271 protein sequence
Red=Cloning site Green=Tags(s)

MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV
LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004049
RefSeq Size 1613
RefSeq ORF 567
Synonyms CAPS1
Locus ID 828
UniProt ID Q13938
Cytogenetics 19p13.3
Summary This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAPS" proteins (7)
SKU Description Size Price
PH315422 CAPS MS Standard C13 and N15-labeled recombinant protein (NP_542157) 10 ug
$3,360.00
LC409138 Lyophilized CAPS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418250 Lyophilized CAPS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409138 Transient overexpression lysate of calcyphosine (CAPS), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418250 Transient overexpression lysate of calcyphosine (CAPS), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310271 Recombinant protein of human calcyphosine (CAPS), transcript variant 1, 20 µg 20 ug
$867.00
TP315422 Recombinant protein of human calcyphosine (CAPS), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products