OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NT5C3 (NT5C3A) (NM_001002009) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309741
Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA330188 Rabbit Polyclonal Anti-NT5C3 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NT5C3 or NM_001002009"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209741 protein sequence
Red=Cloning site Green=Tags(s)

MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNI
IDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDV
MLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHV
FNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVL
VQDESLEVANSILQKIL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001002009
Locus ID 51251
UniProt ID Q9H0P0
Cytogenetics 7p14.3
RefSeq Size 1782
RefSeq ORF 891
Synonyms cN-III; hUMP1; NT5C3; P5'N-1; P5N-1; p36; PN-I; POMP; PSN1; UMPH; UMPH1
Summary This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4. provided by RefSeq, Mar 2012
Protein Categories Cardiovascular diseases, Intracellular Proteins
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NT5C3" proteins (9)
SKU Description Size Price
PH305629 NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_057573) 10 ug
$3,360.00
PH309741 NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_001002009) 10 ug
$3,360.00
LC413931 Lyophilized NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424318 Lyophilized NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424319 Lyophilized NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413931 Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY424318 Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424319 Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305629 Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products