NT5C3 (NT5C3A) (NM_001002009) Human Mass Spec Standard

SKU
PH309741
NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_001002009)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209741]
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC209741 protein sequence
Red=Cloning site Green=Tags(s)

MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNI
IDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDV
MLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHV
FNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVL
VQDESLEVANSILQKIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002009
RefSeq Size 1782
RefSeq ORF 891
Synonyms cN-III; hUMP1; NT5C3; P5'N-1; P5N-1; p36; PN-I; POMP; PSN1; UMPH; UMPH1
Locus ID 51251
UniProt ID Q9H0P0
Cytogenetics 7p14.3
Summary This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4. [provided by RefSeq, Mar 2012]
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism
Write Your Own Review
You're reviewing:NT5C3 (NT5C3A) (NM_001002009) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305629 NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_057573) 10 ug
$3,255.00
LC413931 NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424318 NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424319 NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413931 Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3 100 ug
$436.00
LY424318 Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2 100 ug
$436.00
LY424319 Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1 100 ug
$436.00
TP305629 Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 20 µg 20 ug
$737.00
TP309741 Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.