OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Amyloid Precursor Protein (APP) (NM_201413) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309575
Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500969 Anti-APP (Amyloid beta precursor protein) mouse monoclonal antibody, clone OTI7G9 (formerly 7G9) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Amyloid Precursor Protein or NM_201413"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209575 representing NM_201413
Red=Cloning site Green=Tags(s)

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL
QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER
MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW
GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT
ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAA
STPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKV
ESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTL
KHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLAN
MISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRG
LTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVIT
LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 83 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme substrate (PMID: 25724648)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_958816
Locus ID 351
UniProt ID P05067
Cytogenetics 21q21.3
RefSeq Size 3584
RefSeq ORF 2253
Synonyms AAA; ABETA; ABPP; AD1; alpha-sAPP; APPI; CTFgamma; CVAP; PN-II; PN2; preA4
Summary This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. provided by RefSeq, Aug 2014
Protein Categories Chemokines, Growth Factors, Intracellular Proteins, Membrane Proteins, Nervous system: Neurodegenerative diseases, Secreated Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Alzheimer's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Amyloid Precursor Protein" proteins (11)
SKU Description Size Price
PH309575 APP MS Standard C13 and N15-labeled recombinant protein (NP_958816) 10 ug
$3,360.00
PH315147 APP MS Standard C13 and N15-labeled recombinant protein (NP_958817) 10 ug
$3,360.00
LC404408 Lyophilized APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404409 Lyophilized APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424694 Lyophilized APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427815 Lyophilized APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404408 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404409 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY424694 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY427815 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP315147 Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

Chemoproteomic Profiling of Acetanilide Herbicides Reveals Their Role in Inhibiting Fatty Acid Oxidation
Counihan, Duckering, Dalvie et al
ACS Chem. Biol. (2017)
AI Summary: OriGene's pure proteins were used as substrates in chemoproteomic assays to assess the direct reactivity of acetochlor with protein targets, helping to elucidate the molecular mechanisms by which this herbicide inhibits fatty acid oxidation.
Snippet: Proteome samples diluted in PBS (50 μg in 50 μL PBS) or pure proteins (5 μg in 50 μL PBS, OriGene Technologies, Inc.) were subjected to vehicle or AC treatment for 30 min at 37 °C. Then, IAyne (10 μM, CHESS Gmbh #3187) or ACyne labeling was performed for ... All 3 versions Cite SaveSaving
Specific Amyloid β Clearance by a Catalytic Antibody Construct
Planque, Nishiyama, Sonoda et al
J. Biol. Chem. (2015)
AI Summary: OriGene’s FLAG-tagged APP751 protein was used in the study to assess the specificity of the catalytic antibody construct for amyloid β, demonstrating that the catabody did not hydrolyze the amyloid precursor protein.
Snippet: Aβ40, Aβ1-16, Aβ17-42 or Aβ19-40 (Anaspec, Fremont, CA) were included as competitive inhibitors in the 125I-Aβ40 hydrolysis reaction mixture (0.2 μg/mL nIgV 2E6;3 h, 37°C). Hydrolysis of soluble FLAG-tagged APP751 (83 kDa, 0.1 μM;Origene Technologies, ... Cite SaveSaving
Brain regional correlation of amyloid-β with synapses and apolipoprotein E in non-demented individuals: potential mechanisms underlying regional vulnerability to amyloid-β accumulation
Shinohara, Petersen, Dickson et al
Acta Neuropathol. (2013) 125 (4), 535-47 DOI: 10.1007/s00401-013-1086-9
Cited by 90
AI Summary: OriGene's recombinant human APP proteins were used as standards in ELISA assays to quantify APP-CTFβ levels, aiding the study of amyloid-β metabolism in different brain regions.
Snippet: biotin-conjugated MAB890 detector antibody (R&D, Minneapolis, MN, USA). The recombinant human APP proteins (OriGene, Rockville, MD, USA) were used as standards. The levels of APP-CTFβ were determined by ELISA
Centaurin-α1-Ras-Elk-1 signaling at mitochondria mediates β-amyloid-induced synaptic dysfunction
Szatmari, Oliveira, Sumner et al
J. Neurosci. (2013) 33 (12), 5367-74 DOI: 10.1523/JNEUROSCI.2641-12.2013
Cited by 1
AI Summary: OriGene Technologies supplied the CentA1 and APP cDNAs used in this study to investigate the molecular mechanisms underlying β-amyloid-induced synaptic dysfunction.
Snippet: CentA1 and APP cDNAs were from OriGene Technologies, sh-CentA1 against rat centaurin-α1 was from SuperArray Bioscience, pFR-Luc transcription reporter and pFA2-Elk-1 (PathDetect Elk-1 trans-Reporting System) were from Stratagene, and pcDNA3-myc-Elk-1 and shElk
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products