THEM4 (NM_053055) Human Recombinant Protein

CAT#: TP309396

Recombinant protein of human thioesterase superfamily member 4 (THEM4), 20 µg

Product Images

Coomassie blue staining of purified THEM4 protein (Cat# TP309396). The protein was produced from HEK293T cells transfected with THEM4 cDNA clone (Cat# RC209396) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209396 representing NM_053055
  Red=Cloning site Green=Tags(s)
  
  MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCED
  GSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQG
  GPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFV
  SCNVQSVDEKTLYSEATSLFIKLNPAKSLT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444283
• Locus ID: 117145
• UniProt ID: Q5T1C6, A8K0C9
• Cytogenetics: 1q21.3
• Refseq Size: 2224
• Refseq ORF: 720
• Synonyms: CTMP
• Summary: Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory domain. The protein encoded by this gene negatively regulates PKB activity by inhibiting phosphorylation. Transcription of this gene is commonly downregulated in glioblastomas. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome