THEM4 (NM_053055) Human Mass Spec Standard

SKU
PH309396
THEM4 MS Standard C13 and N15-labeled recombinant protein (NP_444283)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209396]
Predicted MW 26.9 kDa
Protein Sequence
Protein Sequence
>RC209396 representing NM_053055
Red=Cloning site Green=Tags(s)

MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCED
GSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQG
GPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFV
SCNVQSVDEKTLYSEATSLFIKLNPAKSLT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_444283
RefSeq Size 2224
RefSeq ORF 720
Synonyms CTMP
Locus ID 117145
UniProt ID Q5T1C6
Cytogenetics 1q21.3
Summary Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory domain. The protein encoded by this gene negatively regulates PKB activity by inhibiting phosphorylation. Transcription of this gene is commonly downregulated in glioblastomas. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:THEM4 (NM_053055) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403283 THEM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403283 Transient overexpression lysate of thioesterase superfamily member 4 (THEM4) 100 ug
$436.00
TP309396 Recombinant protein of human thioesterase superfamily member 4 (THEM4), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.