THEM4 (NM_053055) Human Tagged ORF Clone

SKU
RC209396
THEM4 (Myc-DDK-tagged)-Human thioesterase superfamily member 4 (THEM4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol THEM4
Synonyms CTMP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209396 representing NM_053055
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGAGGAGCTGCGCCGCGCGCCTCCGCACGCTGGGGGCTCTGTGCCGGCCGCCAGTAGGCCGGCGCC
TGCCGGGAAGCGAGCCGCGACCCGAGCTGAGGTCATTTTCTTCTGAGGAAGTCATTCTTAAGGACTGTTC
TGTCCCCAACCCCAGCTGGAACAAGGACCTAAGACTGCTCTTTGACCAGTTTATGAAGAAATGTGAAGAT
GGCTCCTGGAAACGTTTGCCTTCATATAAACGTACACCTACTGAATGGATTCAAGACTTCAAAACCCATT
TTCTTGACCCAAAGCTTATGAAAGAAGAACAAATGTCACAGGCCCAGCTCTTCACCAGAAGCTTTGATGA
TGGCCTGGGCTTTGAATACGTGATGTTCTACAATGACATTGAGAAAAGGATGGTTTGCTTATTTCAAGGA
GGCCCTTACCTGGAAGGACCACCTGGATTCATTCATGGAGGTGCCATTGCAACCATGATTGATGCTACTG
TTGGTATGTGTGCAATGATGGCTGGGGGAATCGTCATGACTGCCAATCTCAACATCAATTATAAAAGACC
TATCCCTCTTTGTTCTGTTGTTATGATAAATAGCCAACTTGATAAAGTTGAAGGAAGGAAATTTTTTGTT
TCCTGTAATGTTCAGAGTGTTGATGAGAAGACCCTATACTCAGAGGCGACAAGCTTATTTATAAAGCTGA
ATCCTGCTAAAAGTCTGACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209396 representing NM_053055
Red=Cloning site Green=Tags(s)

MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCED
GSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQG
GPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFV
SCNVQSVDEKTLYSEATSLFIKLNPAKSLT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_053055
ORF Size 720 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_053055.2, NP_444283.1
RefSeq Size 2224 bp
RefSeq ORF 723 bp
Locus ID 117145
UniProt ID Q5T1C6
Cytogenetics 1q21.3
Domains 4HBT
Protein Families Druggable Genome
MW 26.9 kDa
Summary Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory domain. The protein encoded by this gene negatively regulates PKB activity by inhibiting phosphorylation. Transcription of this gene is commonly downregulated in glioblastomas. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:THEM4 (NM_053055) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209396L1 Lenti ORF clone of Human thioesterase superfamily member 4 (THEM4), Myc-DDK-tagged 10 ug
$600.00
RC209396L2 Lenti ORF clone of Human thioesterase superfamily member 4 (THEM4), mGFP tagged 10 ug
$600.00
RC209396L3 Lenti ORF clone of Human thioesterase superfamily member 4 (THEM4), Myc-DDK-tagged 10 ug
$600.00
RC209396L4 Lenti ORF clone of Human thioesterase superfamily member 4 (THEM4), mGFP tagged 10 ug
$600.00
RG209396 THEM4 (tGFP-tagged) - Human thioesterase superfamily member 4 (THEM4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC321964 THEM4 (untagged)-Human thioesterase superfamily member 4 (THEM4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.