OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAVIN1 (NM_012232) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309277
Recombinant protein of human polymerase I and transcript release factor (PTRF), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA380559 PTRF Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CAVIN1 or NM_012232"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209277 representing NM_012232
Red=Cloning site Green=Tags(s)

MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQL
TQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEV
NEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSDEAVEVE
EVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTR
LVPAERREKLKTSXDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDE
GGAERGEAGDLRRGSSPDVHALLEITEESDAVLVDKSDSD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036364
Locus ID 284119
UniProt ID Q6NZI2
Cytogenetics 17q21.2
RefSeq Size 3580
RefSeq ORF 1170
Synonyms CAVIN; cavin-1; CGL4; FKSG13; PTRF
Summary This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3' end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy. provided by RefSeq, Nov 2009
Protein Categories Intracellular Proteins
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAVIN1" proteins (3)
SKU Description Size Price
PH309277 PTRF MS Standard C13 and N15-labeled recombinant protein (NP_036364) 10 ug
$3,360.00
LC402171 Lyophilized PTRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402171 Transient overexpression lysate of polymerase I and transcript release factor (PTRF) (as WB positive control) 100 ug
$436.00

file-alt Citations

Deficiency of cold-inducible RNA-binding protein exacerbated monocrotaline-induced pulmonary artery hypertension through Caveolin1 and CAVIN1
Liu, Ke, Wang et al
J Cell Mol Med (2021)
Cited by 17
AI Summary: OriGene's pCMV6-Myc-DDK expression vectors were used to clone and overexpress Cirp, Cav1, and Cavin1 cDNAs in rat pulmonary artery endothelial cells, enabling functional studies of these genes in pulmonary artery hypertension.
Snippet: Page 3. | 3 LIU et aL. For overexpression, Cirp, Cav1 and Cavin1 cDNAs were cloned into pCMV6 tagged with Myc and DDK (Origene), and verified by Sanger sequencing. The constructs were transfected into rPAECs with Lipofectamine 3000 (Invitrogen);- Page 3. | 3 LIU et aL. For overexpression, Cirp, Cav1 and Cavin1 cDNAs were cloned into pCMV6 tagged with Myc and DDK (Origene), and verified by Sanger sequencing. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products