OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAVIN1 (NM_012232) Human Mass Spec Standard

Be the first to review this product
SKU
PH309277
PTRF MS Standard C13 and N15-labeled recombinant protein (NP_036364)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380559 PTRF Rabbit polyclonal Antibody
100 ul
$410.00
LY402171 Transient overexpression lysate of polymerase I and transcript release factor (PTRF) (as WB positive control) 100 ug
$436.00

Other products for "CAVIN1 or NM_012232"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209277
Predicted MW 43.3 kDa
Protein Sequence
Protein Sequence
>RC209277 representing NM_012232
Red=Cloning site Green=Tags(s)

MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQL
TQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEV
NEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSDEAVEVE
EVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTR
LVPAERREKLKTSXDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDE
GGAERGEAGDLRRGSSPDVHALLEITEESDAVLVDKSDSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036364
RefSeq Size 3580
RefSeq ORF 1170
Synonyms CAVIN; cavin-1; CGL4; FKSG13; PTRF
Locus ID 284119
UniProt ID Q6NZI2
Cytogenetics 17q21.2
Summary This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3' end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy. provided by RefSeq, Nov 2009
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAVIN1" proteins (3)
SKU Description Size Price
LC402171 Lyophilized PTRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402171 Transient overexpression lysate of polymerase I and transcript release factor (PTRF) (as WB positive control) 100 ug
$436.00
TP309277 Recombinant protein of human polymerase I and transcript release factor (PTRF), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products