OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RELL2 (NM_173828) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308967
Recombinant protein of human RELT-like 2 (RELL2), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA360731 RELL2 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RELL2 or NM_173828"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208967 protein sequence
Red=Cloning site Green=Tags(s)

MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPEDDDMNED
TVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGPAAPCIHCSRSKR
PPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSRGGQDPGGGQGSGGG
QPKAGMPAMERLPPERPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEA
NGEPSKPDTSDHQVSLPQGAGSM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_776189
Locus ID 285613
UniProt ID Q8NC24
Cytogenetics 5q31.3
RefSeq Size 2599
RefSeq ORF 909
Synonyms C5orf16
Summary Induces activation of MAPK14/p38 cascade, when overexpressed (PubMed:28688764). Induces apoptosis, when overexpressed (PubMed:19969290).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RELL2" proteins (7)
SKU Description Size Price
PH308967 RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_776189) 10 ug
$3,360.00
PH325425 RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_001123501) 10 ug
$3,360.00
LC406433 Lyophilized RELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427113 Lyophilized RELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406433 Transient overexpression lysate of RELT-like 2 (RELL2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427113 Transient overexpression lysate of RELT-like 2 (RELL2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP325425 Recombinant protein of human RELT-like 2 (RELL2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products