RELL2 (NM_001130029) Human Mass Spec Standard

SKU
PH325425
RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_001123501)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225425]
Predicted MW 32.5 kDa
Protein Sequence
Protein Sequence
>RC225425 protein sequence
Red=Cloning site Green=Tags(s)

MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPEDDDMNED
TVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGPAAPCIHCSRSKR
PPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSRGGQDPGGGQGSGGG
QPKAGMPAMERLPPERPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEA
NGEPSKPDTSDHQVSLPQGAGSM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001123501
RefSeq Size 2171
RefSeq ORF 909
Synonyms C5orf16
Locus ID 285613
UniProt ID Q8NC24
Cytogenetics 5q31.3
Summary Induces activation of MAPK14/p38 cascade, when overexpressed (PubMed:28688764). Induces apoptosis, when overexpressed (PubMed:19969290).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:RELL2 (NM_001130029) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308967 RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_776189) 10 ug
$3,255.00
LC406433 RELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427113 RELL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406433 Transient overexpression lysate of RELT-like 2 (RELL2), transcript variant 1 100 ug
$436.00
LY427113 Transient overexpression lysate of RELT-like 2 (RELL2), transcript variant 2 100 ug
$436.00
TP308967 Recombinant protein of human RELT-like 2 (RELL2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325425 Recombinant protein of human RELT-like 2 (RELL2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.