OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Synaptotagmin 1 (SYT1) (NM_005639) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308938
Purified recombinant protein of Homo sapiens synaptotagmin I (SYT1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA314581 Rabbit polyclonal Synaptotagmin (Thr202) antibody(Phospho-specific)
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Synaptotagmin 1 or NM_005639"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208938 representing NM_005639
Red=Cloning site Green=Tags(s)

MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVL
LVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEE
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ
FTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFS
LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF
EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
KK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005630
Locus ID 6857
UniProt ID P21579
Cytogenetics 12q21.2
RefSeq Size 3244
RefSeq ORF 1266
Synonyms BAGOS; P65; SVP65; SYT
Summary The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 PubMed 11242035).supplied by OMIM, Jul 2010
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Synaptotagmin 1" proteins (11)
SKU Description Size Price
PH308938 SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_005630) 10 ug
$3,360.00
PH327105 SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129277) 10 ug
$3,360.00
PH327252 SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129278) 10 ug
$3,360.00
LC417170 Lyophilized SYT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427710 Lyophilized SYT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427711 Lyophilized SYT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417170 Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427710 Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427711 Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP327105 Recombinant protein of human synaptotagmin I (SYT1), transcript variant 2, 20 µg 20 ug
$737.00
TP327252 Recombinant protein of human synaptotagmin I (SYT1), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products