Synaptotagmin 1 (SYT1) (NM_001135805) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC227105] |
Predicted MW | 47.4 kDa |
Protein Sequence |
Protein Sequence
>RC227105 representing NM_001135805
Red=Cloning site Green=Tags(s) MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVL LVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEE EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ FTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFS LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV KK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001129277 |
RefSeq ORF | 1266 |
Synonyms | BAGOS; P65; SVP65; SYT |
Locus ID | 6857 |
UniProt ID | P21579 |
Cytogenetics | 12q21.2 |
Summary | The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).[supplied by OMIM, Jul 2010] |
Protein Families | Secreted Protein, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308938 | SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_005630) | 10 ug |
$3,255.00
|
|
PH327252 | SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129278) | 10 ug |
$3,255.00
|
|
LC417170 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427710 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427711 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY417170 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 1 | 100 ug |
$436.00
|
|
LY427710 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 2 | 100 ug |
$436.00
|
|
LY427711 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 3 | 100 ug |
$436.00
|
|
TP308938 | Purified recombinant protein of Homo sapiens synaptotagmin I (SYT1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP327105 | Recombinant protein of human synaptotagmin I (SYT1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP327252 | Recombinant protein of human synaptotagmin I (SYT1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.