Synaptotagmin 1 (SYT1) (NM_001135806) Human Mass Spec Standard

SKU
PH327252
SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129278)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227252]
Predicted MW 47.4 kDa
Protein Sequence
Protein Sequence
>RC227252 representing NM_001135806
Red=Cloning site Green=Tags(s)

MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVL
LVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEE
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ
FTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFS
LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF
EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
KK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129278
RefSeq ORF 1266
Synonyms BAGOS; P65; SVP65; SYT
Locus ID 6857
UniProt ID P21579
Cytogenetics 12q21.2
Summary The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).[supplied by OMIM, Jul 2010]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:Synaptotagmin 1 (SYT1) (NM_001135806) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308938 SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_005630) 10 ug
$3,255.00
PH327105 SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129277) 10 ug
$3,255.00
LC417170 SYT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427710 SYT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427711 SYT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417170 Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 1 100 ug
$436.00
LY427710 Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 2 100 ug
$436.00
LY427711 Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 3 100 ug
$436.00
TP308938 Purified recombinant protein of Homo sapiens synaptotagmin I (SYT1), transcript variant 1, 20 µg 20 ug
$737.00
TP327105 Recombinant protein of human synaptotagmin I (SYT1), transcript variant 2, 20 µg 20 ug
$737.00
TP327252 Recombinant protein of human synaptotagmin I (SYT1), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.