ROR beta (RORB) (NM_006914) Human Recombinant Protein

CAT#: TP308666

Recombinant protein of human RAR-related orphan receptor B (RORB), 20 µg

Product Images

Coomassie blue staining of purified RORB protein (Cat# TP308666). The protein was produced from HEK293T cells transfected with RORB cDNA clone (Cat# RC208666) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208666 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKC
  LALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNGLSNLNNETSGT
  YANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMT
  EIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRI
  TGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLC
  SLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
  NLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 51.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008845
• Locus ID: 6096
• UniProt ID: Q58EY0
• Cytogenetics: 9q21.13
• Refseq Size: 3604
• Refseq ORF: 1377
• Synonyms: bA133M9.1; EIG15; NR1F2; ROR-BETA; RZR-BETA; RZRB
• Summary: The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, and to help regulate the expression of some genes involved in circadian rhythm. [provided by RefSeq, Feb 2014]
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors