ROR beta (RORB) (NM_006914) Human Mass Spec Standard

SKU
PH308666
RORB MS Standard C13 and N15-labeled recombinant protein (NP_008845)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208666]
Predicted MW 52.1 kDa
Protein Sequence
Protein Sequence
>RC208666 protein sequence
Red=Cloning site Green=Tags(s)

MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKC
LALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNGLSNLNNETSGT
YANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMT
EIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRI
TGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLC
SLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
NLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008845
RefSeq Size 3604
RefSeq ORF 1377
Synonyms bA133M9.1; EIG15; NR1F2; ROR-BETA; RZR-BETA; RZRB
Locus ID 6096
UniProt ID Q58EY0
Cytogenetics 9q21.13
Summary The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, and to help regulate the expression of some genes involved in circadian rhythm. [provided by RefSeq, Feb 2014]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Write Your Own Review
You're reviewing:ROR beta (RORB) (NM_006914) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402058 RORB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402058 Transient overexpression lysate of RAR-related orphan receptor B (RORB) 100 ug
$436.00
TP308666 Recombinant protein of human RAR-related orphan receptor B (RORB), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.