SPCS3 (NM_021928) Human Recombinant Protein

CAT#: TP308380

Recombinant protein of human signal peptidase complex subunit 3 homolog (S. cerevisiae) (SPCS3), 20 µg

Product Images

Coomassie blue staining of purified SPCS3 protein (Cat# TP308380). The protein was produced from HEK293T cells transfected with SPCS3 cDNA clone (Cat# RC208380) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208380 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDI
  TADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNR
  NVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068747
• Locus ID: 60559
• UniProt ID: P61009
• Cytogenetics: 4q34.2
• Refseq Size: 4596
• Refseq ORF: 540
• Synonyms: PRO3567; SPC3; SPC22; SPC22/23; SPC23; YLR066W
• Summary: Component of the microsomal signal peptidase complex which removes signal peptides and other N-terminal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
• Protein Families: Protease, Transmembrane