OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPCS3 (NM_021928) Human Mass Spec Standard

Be the first to review this product
SKU
PH308380
SPCS3 MS Standard C13 and N15-labeled recombinant protein (NP_068747)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333715 Rabbit Polyclonal Anti-SPCS3 Antibody
100 ul
$585.00
LY411894 Transient overexpression lysate of signal peptidase complex subunit 3 homolog (S. cerevisiae) (SPCS3) (as WB positive control) 100 ug
$436.00

Other products for "SPCS3 or NM_021928"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208380
Predicted MW 20.3 kDa
Protein Sequence
Protein Sequence
>RC208380 protein sequence
Red=Cloning site Green=Tags(s)

MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDI
TADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNR
NVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068747
RefSeq Size 4596
RefSeq ORF 540
Synonyms PRO3567; SPC3; SPC22; SPC22/23; SPC23; YLR066W
Locus ID 60559
UniProt ID P61009
Cytogenetics 4q34.2
Summary Component of the microsomal signal peptidase complex which removes signal peptides and other N-terminal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.UniProtKB/Swiss-Prot Function
Protein Families Protease, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPCS3" proteins (3)
SKU Description Size Price
LC411894 Lyophilized SPCS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411894 Transient overexpression lysate of signal peptidase complex subunit 3 homolog (S. cerevisiae) (SPCS3) (as WB positive control) 100 ug
$436.00
TP308380 Recombinant protein of human signal peptidase complex subunit 3 homolog (S. cerevisiae) (SPCS3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products