SYS1 (NM_033542) Human Recombinant Protein

CAT#: TP308279

Recombinant protein of human SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) (SYS1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified SYS1 protein (Cat# TP308279). The protein was produced from HEK293T cells transfected with SYS1 cDNA clone (Cat# RC208279) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208279 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSF
  ILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMR
  TELKEIPLNSAPKSNV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_291020
• Locus ID: 90196
• UniProt ID: Q8N2H4
• Cytogenetics: 20q13.12
• Refseq Size: 2802
• Refseq ORF: 468
• Synonyms: C20orf169; dJ453C12.4; dJ453C12.4.1
• Summary: SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus (Behnia et al., 2004 [PubMed 15077113]).[supplied by OMIM, Aug 2009]
• Protein Families: Transmembrane