OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SYS1 (NM_033542) Human Mass Spec Standard

Be the first to review this product
SKU
PH308279
SYS1 MS Standard C13 and N15-labeled recombinant protein (NP_291020)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359543 SYS1 Antibody - C-terminal
100 ul
$585.00
LY409493 Transient overexpression lysate of SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) (SYS1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SYS1 or NM_033542"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208279
Predicted MW 17.6 kDa
Protein Sequence
Protein Sequence
>RC208279 protein sequence
Red=Cloning site Green=Tags(s)

MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSF
ILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMR
TELKEIPLNSAPKSNV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_291020
RefSeq Size 2802
RefSeq ORF 468
Synonyms C20orf169; dJ453C12.4; dJ453C12.4.1
Locus ID 90196
UniProt ID Q8N2H4
Cytogenetics 20q13.12
Summary SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus (Behnia et al., 2004 PubMed 15077113).supplied by OMIM, Aug 2009
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SYS1" proteins (3)
SKU Description Size Price
LC409493 Lyophilized SYS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409493 Transient overexpression lysate of SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) (SYS1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308279 Recombinant protein of human SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) (SYS1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products