OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OLIG2 (NM_005806) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308209
Recombinant protein of human oligodendrocyte lineage transcription factor 2 (OLIG2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349037 Rabbit Polyclonal Anti-OLIG2 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "OLIG2 or NM_005806"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC208209
Blue=ORF Red=Cloning site Green=Tag(s)

MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDK
LGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYA
HGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAA
AAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGG
GGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK
myc-FLAG tag

Recombinant protein using RC208209 also available, TP308209
Tag C-Myc/DDK
Predicted MW 32.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005797
Locus ID 10215
UniProt ID Q13516
Cytogenetics 21q22.11
RefSeq Size 2505
RefSeq ORF 969
Synonyms BHLHB1; bHLHe19; OLIGO2; PRKCBP2; RACK17
Summary This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OLIG2" proteins (4)
SKU Description Size Price
PH308209 OLIG2 MS Standard C13 and N15-labeled recombinant protein (NP_005797) 10 ug
$3,360.00
LC417055 Lyophilized OLIG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417055 Transient overexpression lysate of oligodendrocyte lineage transcription factor 2 (OLIG2) (as WB positive control) 100 ug
$436.00
TP762359 Purified recombinant protein of Human oligodendrocyte lineage transcription factor 2 (OLIG2), Met1-Arg120, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products