OLIG2 (NM_005806) Human Mass Spec Standard

SKU
PH308209
OLIG2 MS Standard C13 and N15-labeled recombinant protein (NP_005797)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208209]
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC208209
Blue=ORF Red=Cloning site Green=Tag(s)

MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDK
LGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYA
HGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAA
AAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGG
GGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK

myc-FLAG tag

Recombinant protein using RC208209 also available, TP308209
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005797
RefSeq Size 2505
RefSeq ORF 969
Synonyms BHLHB1; bHLHe19; OLIGO2; PRKCBP2; RACK17
Locus ID 10215
UniProt ID Q13516
Cytogenetics 21q22.11
Summary This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:OLIG2 (NM_005806) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417055 OLIG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417055 Transient overexpression lysate of oligodendrocyte lineage transcription factor 2 (OLIG2) 100 ug
$436.00
TP308209 Recombinant protein of human oligodendrocyte lineage transcription factor 2 (OLIG2), 20 µg 20 ug
$867.00
TP762359 Purified recombinant protein of Human oligodendrocyte lineage transcription factor 2 (OLIG2), Met1-Arg120, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.