OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

p63 (TP63) (NM_003722) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308013
Recombinant protein of human tumor protein p63 (TP63), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA802078 TP63 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "p63 or NM_003722"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208013 protein sequence
Red=Cloning site Green=Tags(s)

MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQ
PIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQ
NSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCP
IQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPI
TGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGR
DRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNAL
TPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSS
CLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGS
SETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 76.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003713
Locus ID 8626
UniProt ID Q9H3D4
Cytogenetics 3q28
RefSeq Size 4927
RefSeq ORF 2040
Synonyms AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Summary This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gene and the use of alternative promoters results in multiple transcript variants encoding different isoforms that vary in their functional properties. These isoforms function during skin development and maintenance, adult stem/progenitor cell regulation, heart development and premature aging. Some isoforms have been found to protect the germline by eliminating oocytes or testicular germ cells that have suffered DNA damage. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. provided by RefSeq, Aug 2016
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "p63" proteins (12)
SKU Description Size Price
PH308013 TP63 MS Standard C13 and N15-labeled recombinant protein (NP_003713) 10 ug
$3,360.00
LC418475 Lyophilized TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426514 Lyophilized TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426515 Lyophilized TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426516 Lyophilized TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426518 Lyophilized TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418475 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426514 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426515 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY426516 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY426518 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP710041 Recombinant protein of human tumor protein p63 (TP63), transcript variant 1, with C-terminal DDK tag,expressed in sf9 cells. 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products