p63 (TP63) (NM_003722) Human Mass Spec Standard

SKU
PH308013
TP63 MS Standard C13 and N15-labeled recombinant protein (NP_003713)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208013]
Predicted MW 76.8 kDa
Protein Sequence
Protein Sequence
>RC208013 protein sequence
Red=Cloning site Green=Tags(s)

MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQ
PIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQ
NSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCP
IQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPI
TGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGR
DRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNAL
TPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSS
CLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGS
SETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003713
RefSeq Size 4927
RefSeq ORF 2040
Synonyms AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L
Locus ID 8626
UniProt ID Q9H3D4
Cytogenetics 3q28
Summary This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gene and the use of alternative promoters results in multiple transcript variants encoding different isoforms that vary in their functional properties. These isoforms function during skin development and maintenance, adult stem/progenitor cell regulation, heart development and premature aging. Some isoforms have been found to protect the germline by eliminating oocytes or testicular germ cells that have suffered DNA damage. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:p63 (TP63) (NM_003722) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418475 TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426514 TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426515 TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426516 TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426518 TP63 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418475 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 1 100 ug
$436.00
LY426514 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 2 100 ug
$436.00
LY426515 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 3 100 ug
$436.00
LY426516 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 4 100 ug
$436.00
LY426518 Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 6 100 ug
$436.00
TP308013 Recombinant protein of human tumor protein p63 (TP63), transcript variant 1, 20 µg 20 ug
$737.00
TP710041 Recombinant protein of human tumor protein p63 (TP63), transcript variant 1, with C-terminal DDK tag,expressed in sf9 cells. 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.