OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

THAP1 (NM_018105) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306000
Recombinant protein of human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "THAP1 or NM_018105"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206000 protein sequence
Red=Cloning site Green=Tags(s)

MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNK
LLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVE
DTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVE
VPA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060575
Locus ID 55145
UniProt ID Q9NVV9
Cytogenetics 8p11.21
RefSeq Size 2189
RefSeq ORF 639
Synonyms DYT6
Summary The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Nervous system Diseases, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "THAP1" proteins (5)
SKU Description Size Price
PH306000 THAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060575) 10 ug
$3,360.00
LC404715 Lyophilized THAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413231 Lyophilized THAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404715 Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY413231 Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products