OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

THAP1 (NM_018105) Human Mass Spec Standard

Be the first to review this product
SKU
PH306000
THAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060575)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404715 Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "THAP1 or NM_018105"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206000
Predicted MW 24.9 kDa
Protein Sequence
Protein Sequence
>RC206000 protein sequence
Red=Cloning site Green=Tags(s)

MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNK
LLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVE
DTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVE
VPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060575
RefSeq Size 2189
RefSeq ORF 639
Synonyms DYT6
Locus ID 55145
UniProt ID Q9NVV9
Cytogenetics 8p11.21
Summary The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "THAP1" proteins (5)
SKU Description Size Price
LC404715 Lyophilized THAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413231 Lyophilized THAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404715 Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY413231 Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306000 Recombinant protein of human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products