MOBKL2B (MOB3B) (NM_024761) Human Recombinant Protein

CAT#: TP305977

Recombinant protein of human MOB1, Mps One Binder kinase activator-like 2B (yeast) (MOBKL2B), 20 µg

Product Images

Coomassie blue staining of purified MOB3B protein (Cat# TP305977). The protein was produced from HEK293T cells transfected with MOB3B cDNA clone (Cat# RC205977) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205977 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNR
  INLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVG
  VPFPKNFLQICMKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEM
  TSRMCH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079037
• Locus ID: 79817
• UniProt ID: Q86TA1
• Cytogenetics: 9p21.2
• Refseq Size: 6528
• Refseq ORF: 648
• Synonyms: C9orf35; MOB1D; MOBKL2B
• Summary: The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. [provided by RefSeq, Jul 2008]