MOBKL2B (MOB3B) (NM_024761) Human Mass Spec Standard

SKU
PH305977
MOBKL2B MS Standard C13 and N15-labeled recombinant protein (NP_079037)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205977]
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC205977 protein sequence
Red=Cloning site Green=Tags(s)

MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNR
INLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVG
VPFPKNFLQICMKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEM
TSRMCH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079037
RefSeq Size 6528
RefSeq ORF 648
Synonyms C9orf35; MOB1D; MOBKL2B
Locus ID 79817
UniProt ID Q86TA1
Cytogenetics 9p21.2
Summary The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MOBKL2B (MOB3B) (NM_024761) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403025 MOB3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403025 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 2B (yeast) (MOBKL2B) 100 ug
$436.00
TP305977 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 2B (yeast) (MOBKL2B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.