OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOBKL2B (MOB3B) (NM_024761) Human Mass Spec Standard

Be the first to review this product
SKU
PH305977
MOBKL2B MS Standard C13 and N15-labeled recombinant protein (NP_079037)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501501 Anti-MOBKL2B mouse monoclonal antibody, clone OTI6C6 (formerly 6C6) 100 ul
$447.00
LY403025 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 2B (yeast) (MOBKL2B) (as WB positive control) 100 ug
$436.00

Other products for "MOBKL2B or NM_024761"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205977
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC205977 protein sequence
Red=Cloning site Green=Tags(s)

MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNR
INLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVG
VPFPKNFLQICMKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEM
TSRMCH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079037
RefSeq Size 6528
RefSeq ORF 648
Synonyms C9orf35; MOB1D; MOBKL2B
Locus ID 79817
UniProt ID Q86TA1
Cytogenetics 9p21.2
Summary The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MOBKL2B" proteins (3)
SKU Description Size Price
LC403025 Lyophilized MOB3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403025 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 2B (yeast) (MOBKL2B) (as WB positive control) 100 ug
$436.00
TP305977 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 2B (yeast) (MOBKL2B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products