OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HDHD2 (NM_032124) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305967
Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502834 HDHD2 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HDHD2 or NM_032124"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205967 protein sequence
Red=Cloning site Green=Tags(s)

MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISED
EIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPL
IAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDV
GGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115500
Locus ID 84064
UniProt ID Q9H0R4
Cytogenetics 18q21.1
RefSeq Size 2245
RefSeq ORF 777
Synonyms 3110052N05Rik; HEL-S-301
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HDHD2" proteins (4)
SKU Description Size Price
PH305967 HDHD2 MS Standard C13 and N15-labeled recombinant protein (NP_115500) 10 ug
$3,360.00
LC403144 Lyophilized HDHD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403144 Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2) (as WB positive control) 100 ug
$436.00
TP720246 Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products