HDHD2 (NM_032124) Human Mass Spec Standard

SKU
PH305967
HDHD2 MS Standard C13 and N15-labeled recombinant protein (NP_115500)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205967]
Predicted MW 28.5 kDa
Protein Sequence
Protein Sequence
>RC205967 protein sequence
Red=Cloning site Green=Tags(s)

MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISED
EIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPL
IAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDV
GGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115500
RefSeq Size 2245
RefSeq ORF 777
Synonyms 3110052N05Rik; HEL-S-301
Locus ID 84064
UniProt ID Q9H0R4
Cytogenetics 18q21.1
Write Your Own Review
You're reviewing:HDHD2 (NM_032124) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403144 HDHD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403144 Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2) 100 ug
$436.00
TP305967 Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720246 Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.