PSMA3 (NM_002788) Human Recombinant Protein

CAT#: TP305917

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 3 (PSMA3), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified PSMA3 protein (Cat# TP305917). The protein was produced from HEK293T cells transfected with PSMA3 cDNA clone (Cat# RC205917) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205917 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNV
  DRHVGMAVAGLLADARSLADMAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGS
  YSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAF
  ELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 28.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002779
• Locus ID: 5684
• UniProt ID: P25788, A0A140VK43
• Cytogenetics: 14q23.1
• Refseq Size: 1014
• Refseq ORF: 765
• Synonyms: HC8; PSC3
• Summary: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protease, Stem cell - Pluripotency
• Protein Pathways: Proteasome