OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMA3 (NM_002788) Human Mass Spec Standard

Be the first to review this product
SKU
PH305917
PSMA3 MS Standard C13 and N15-labeled recombinant protein (NP_002779)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407718 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 3 (PSMA3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PSMA3 or NM_002788"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205917
Predicted MW 28.5 kDa
Protein Sequence
Protein Sequence
>RC205917 protein sequence
Red=Cloning site Green=Tags(s)

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNV
DRHVGMAVAGLLADARSLADMAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGS
YSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAF
ELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002779
RefSeq Size 1014
RefSeq ORF 765
Synonyms HC8; PSC3
Locus ID 5684
UniProt ID P25788
Cytogenetics 14q23.1
Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protease, Stem cell - Pluripotency
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMA3" proteins (5)
SKU Description Size Price
LC407718 Lyophilized PSMA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419116 Lyophilized PSMA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407718 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 3 (PSMA3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419116 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 3 (PSMA3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305917 Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 3 (PSMA3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products