CCDC107 (NM_174923) Human Recombinant Protein

CAT#: TP305865

Recombinant protein of human coiled-coil domain containing 107 (CCDC107), 20 µg

Product Images

Coomassie blue staining of purified CCDC107 protein (Cat# TP305865). The protein was produced from HEK293T cells transfected with CCDC107 cDNA clone (Cat# RC205865) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205865 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGA
  LYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTT
  LAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPED
  FCLKEDEEEVGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQS
  LFS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_777583
• Locus ID: 203260
• UniProt ID: Q8WV48
• Cytogenetics: 9p13.3
• Refseq Size: 1272
• Refseq ORF: 851
• Synonyms: PSEC0222
• Summary: This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]
• Protein Families: Transmembrane